PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3447_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 139aa    MW: 16179.7 Da    PI: 7.8312
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3447_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.52.9e-4162138278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 Cqve+C+ad+s+ak+yh+rhkvCe+h+kap+v + g  qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk+++
  RrC3447_p1  62 CQVERCTADMSRAKQYHKRHKVCEFHAKAPAVRIFGGYQRFCQQCSRFHELREFDEAKRSCRRRLAGHNERRRKSTN 138
                 **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375759.9E-551139IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.1E-3155123IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.42859136IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-3661137IPR004333Transcription factor, SBP-box
PfamPF031102.8E-3162135IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MSVRRSNADG KRSLREMSEE EEEDEDTFEE EDNGGEQEQE EALEKKQKGK AASSSTSSGV  60
SCQVERCTAD MSRAKQYHKR HKVCEFHAKA PAVRIFGGYQ RFCQQCSRFH ELREFDEAKR  120
SCRRRLAGHN ERRRKSTNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3854135284squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013680760.13e-66PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013744508.13e-66PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013744507.13e-66PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013626500.13e-66PREDICTED: squamosa promoter-binding-like protein 3
SwissprotP930155e-58SPL3_ARATH; Squamosa promoter-binding-like protein 3
TrEMBLA0A078CU668e-66A0A078CU66_BRANA; BnaC03g18800D protein
TrEMBLA0A0D3B4R88e-66A0A0D3B4R8_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.4__1394__AT2G33810.13e-58(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.19e-45squamosa promoter binding protein-like 3